Your Position: Home > Recombinant Proteins > Recombinant Human Erythropoietin,EPO (C-6His)

Recombinant Human Erythropoietin,EPO (C-6His)

AP74768
Review: comment rank 5 pdf
  Catalog No. Package Size Price
AP74768-1 10ug $219.00
AP74768-2 50ug $389.00
AP74768-3 500ug $1179.00
AP74768-4 1mg $1809.00

Quantity:  Total:   
 

Availability: promotionone week

add promotion
Description
  • Product Name Recombinant Human Erythropoietin,EPO (C-6His)
  • Host Species Human Cells
  • Purification Greater than 95% as determined by reducing SDS-PAGE.
  • Specificity Human
  • Endotoxin Less than 0.1 ng,μg (1 IEU,μg) as determined by LAL test.
  • Accession No. P01588
  • Calculated MW 19.2kDa
  • Target Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDRHHHHHH
  • Formulation Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
  • Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
    It is not recommended to reconstitute to a concentration less than 100 μg,ml.
    Dissolve the lyophilized protein in ddH2O.
    Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • Storage Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
    Reconstituted protein solution can be stored at 4-7C for 2-7 days.
    Aliquots of reconstituted samples are stable at < -20C for 3 months.
    Please let us know if you have published research using #AP74768 so that we can cite your reference.
Customer Reviews and Rankings
  • No comment
  • Total 0 results, divided into1 pages. First Prev Next Last

    My Review

    Username: Anonymous user
    E-mail:
    Ratings:
    Content:
    Verification code: captcha
     
    Protocol
    Browsing historyclear
    Note
      Application:
    • WBWestern Blotting
    • IHCImmunohistochemistry
    • IFImmunofluorescence
    • ICCImmunocytochemistry
    • FCFlow Cytometry
    • IPImmunoprecipitation
    • EELISA
    • DBDot Blotting
    • ChIPChromatin Immunoprecipitation
    • GICAGold Immunochromatography Assay
    • NCNegative Control
      Species Reactivity:
    • HuHuman
    • MsMouse 
    • RtRat 
    • Dm Drosophila melanogaster
    • C Caenorhabditis elegans
    • MkMonkey
    • RbRabbit
    • B Bovine 
    • D Dog
    • PPig
    • HmHamster
    • ChHm Chinese Hamster 
    • ChkChicken  
    • ShpSheep  
      SUBSCRIBE OUR E-MAIL
    • Inspiration, ideas and your feedback.
    FOLLOW US

    facebook twitter linkedin

    sab © 2017 Signalway Antibody LLC. All Rights Reserved.  E-mail: info@signalwayantibody.com