Your Position: Home > Recombinant Proteins > Recombinant human Transforming growth factor beta-1 protein

Recombinant human Transforming growth factor beta-1 protein

AP71968
Review: comment rank 5 pdf
  Catalog No. Package Size Price
AP71968-1 50ug $235.00
AP71968-2 200ug $470.00
AP71968-3 500ug $940.00
AP71968-4 1mg $1415.00

Quantity:  Total:   
 

Availability: promotionThe lead time is currently 7-30 days.

add promotion
Description
  • Product Name Recombinant human Transforming growth factor beta-1 protein
  • Brief Description Recombinant Protein
  • Host Species E.coli
  • Target Name TGFB1
  • Accession No. Uniprot ID: P01137
  • Target Species HUMAN
  • Calculated MW 16.7kD
  • Target Length Partial of the full length of 279-390aa, 281-390aa
  • Tag Info His-tag
  • Target Sequence DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
  • Formulation 20mM Tris-HCl based buffer,pH8.0
  • Storage Store at -20˚C, for extended storage, conserve at -20˚C or -80˚C. Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details

Purity: Greater than 90% as determined by SDS-PAGE.

Images
  • Recombinant human Transforming growth factor beta-1 protein - SAB | Signalway Antibody


Background

Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone rodeling as it is a potent stimulator of osteoblastic bone formation, causing chotaxis, proliferation and differentiation in committed osteoblasts. Can promote either T-helper 17 cells (Th17) or regulatory T-cells (Treg) lineage differentiation in a concentration-dependent manner. At high concentrations, leads to FOXP3-mediated suppression of RORC and down-regulation of IL-17 expression, favoring Treg cell development. At low concentrations in concert with IL-6 and IL-21, leads to expression of the IL-17 and IL-23 receptors, favoring differentiation to Th17 cells.

    Please let us know if you have published research using #AP71968 so that we can cite your reference.
Customer Reviews and Rankings
  • No comment
  • Total 0 results, divided into1 pages. First Prev Next Last

    My Review

    Username: Anonymous user
    E-mail:
    Ratings:
    Content:
    Verification code: captcha
     
    Protocol
    Browsing historyclear
    Note
      Application:
    • WBWestern Blotting
    • IHCImmunohistochemistry
    • IFImmunofluorescence
    • ICCImmunocytochemistry
    • FCFlow Cytometry
    • IPImmunoprecipitation
    • EELISA
    • DBDot Blotting
    • ChIPChromatin Immunoprecipitation
    • GICAGold Immunochromatography Assay
    • NCNegative Control
      Species Reactivity:
    • HuHuman
    • MsMouse 
    • RtRat 
    • Dm Drosophila melanogaster
    • C Caenorhabditis elegans
    • MkMonkey
    • RbRabbit
    • B Bovine 
    • D Dog
    • PPig
    • HmHamster
    • ChHm Chinese Hamster 
    • ChkChicken  
    • ShpSheep  
      SUBSCRIBE OUR E-MAIL
    • Inspiration, ideas and your feedback.
    FOLLOW US

    facebook twitter linkedin

    sab © 2017 Signalway Antibody LLC. All Rights Reserved.  E-mail: info@signalwayantibody.com