Your Position: Home > Recombinant Proteins > Recombinant human Caspase-8

Recombinant human Caspase-8

AP72375
Review: comment rank 5 pdf
  Catalog No. Package Size Price
AP72375 50ug $260.00

Quantity:  Total:   
 

Availability: promotionThe lead time is currently 7-30 days.

add promotion
Description
  • Product Name Recombinant human Caspase-8
  • Brief Description Recombinant Protein
  • Host Species E.coli
  • Accession No. Uniprot ID: Q14790
  • Calculated MW 22kD
  • Target Length 217-374aa
  • Tag Info His-tag
  • Target Sequence SESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETD
  • Formulation 20mM Tris-HCl based buffer,pH8.0
  • Storage Store at -20˚C, for extended storage, conserve at -20˚C or -80˚C. Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details

Purity: Greater than 90% as determined by SDS-PAGE.

    Please let us know if you have published research using #AP72375 so that we can cite your reference.
Customer Reviews and Rankings
  • No comment
  • Total 0 results, divided into1 pages. First Prev Next Last

    My Review

    Username: Anonymous user
    E-mail:
    Ratings:
    Content:
    Verification code: captcha
     
    Protocol
    Browsing historyclear
    Note
      Application:
    • WBWestern Blotting
    • IHCImmunohistochemistry
    • IFImmunofluorescence
    • ICCImmunocytochemistry
    • FCFlow Cytometry
    • IPImmunoprecipitation
    • EELISA
    • DBDot Blotting
    • ChIPChromatin Immunoprecipitation
    • GICAGold Immunochromatography Assay
    • NCNegative Control
      Species Reactivity:
    • HuHuman
    • MsMouse 
    • RtRat 
    • Dm Drosophila melanogaster
    • C Caenorhabditis elegans
    • MkMonkey
    • RbRabbit
    • B Bovine 
    • D Dog
    • PPig
    • HmHamster
    • ChHm Chinese Hamster 
    • ChkChicken  
    • ShpSheep  
      SUBSCRIBE OUR E-MAIL
    • Inspiration, ideas and your feedback.
    FOLLOW US

    facebook twitter linkedin

    sab © 2017 Signalway Antibody LLC. All Rights Reserved.  E-mail: info@signalwayantibody.com