Your Position: Home > Recombinant Proteins > Recombinant Rat Carbonic anhydrase 1(Ca1)

Recombinant Rat Carbonic anhydrase 1(Ca1)

AP73669
Review: comment rank 5 pdf
  Catalog No. Package Size Price
AP73669-1 10ug $105.00
AP73669-2 50ug $260.00
AP73669-3 100ug $454.00
AP73669-4 200ug $735.00
AP73669-5 500ug $1240.00
AP73669-6 1mg $1980.00

Quantity:  Total:   
 

Availability: promotionThe lead time is currently 7-30 days.

add promotion
Description
  • Product Name Recombinant Rat Carbonic anhydrase 1(Ca1)
  • Brief Description Recombinant Protein
  • Host Species E.coli
  • Target Name Ca1
  • Alternative Names Carbonate dehydratase I
  • Accession No. Uniprot ID: B0BNN3
  • Target Species Rt
  • SDS-PAGE MW 31.8kDa
  • Target Length Full Length,2-261aa
  • Tag Info N-terminal 13xHis-SUMO-tagged
  • Target Sequence ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF
  • Formulation Tris-based buffer,50% glycerol
  • Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.
Application Details

Greater than 90% as determined by SDS-PAGE.

Images
  • Recombinant Rat Carbonic anhydrase 1(Ca1) - SAB | Signalway Antibody


Background
Reversible hydration of carbon dioxide.Curated
Regerences
Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Proteome profile of the mature rat olfactory bulb.Maurya D.K., Sundaram C.S., Bhargava P.Proteomics 9:2593-2599(2009)
    Please let us know if you have published research using #AP73669 so that we can cite your reference.
Customer Reviews and Rankings
  • No comment
  • Total 0 results, divided into1 pages. First Prev Next Last

    My Review

    Username: Anonymous user
    E-mail:
    Ratings:
    Content:
    Verification code: captcha
     
    Protocol
    Browsing historyclear
    Note
      Application:
    • WBWestern Blotting
    • IHCImmunohistochemistry
    • IFImmunofluorescence
    • ICCImmunocytochemistry
    • FCFlow Cytometry
    • IPImmunoprecipitation
    • EELISA
    • DBDot Blotting
    • ChIPChromatin Immunoprecipitation
    • GICAGold Immunochromatography Assay
    • NCNegative Control
      Species Reactivity:
    • HuHuman
    • MsMouse 
    • RtRat 
    • Dm Drosophila melanogaster
    • C Caenorhabditis elegans
    • MkMonkey
    • RbRabbit
    • B Bovine 
    • D Dog
    • PPig
    • HmHamster
    • ChHm Chinese Hamster 
    • ChkChicken  
    • ShpSheep  
      SUBSCRIBE OUR E-MAIL
    • Inspiration, ideas and your feedback.
    FOLLOW US

    facebook twitter linkedin

    sab © 2017 Signalway Antibody LLC. All Rights Reserved.  E-mail: info@signalwayantibody.com